Anti SNX11 pAb (ATL-HPA044787)

Atlas Antibodies

Catalog No.:
ATL-HPA044787-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sorting nexin 11
Gene Name: SNX11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020876: 91%, ENSRNOG00000008642: 90%
Entrez Gene ID: 29916
Uniprot ID: Q9Y5W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSP
Gene Sequence LFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSP
Gene ID - Mouse ENSMUSG00000020876
Gene ID - Rat ENSRNOG00000008642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX11 pAb (ATL-HPA044787)
Datasheet Anti SNX11 pAb (ATL-HPA044787) Datasheet (External Link)
Vendor Page Anti SNX11 pAb (ATL-HPA044787) at Atlas Antibodies

Documents & Links for Anti SNX11 pAb (ATL-HPA044787)
Datasheet Anti SNX11 pAb (ATL-HPA044787) Datasheet (External Link)
Vendor Page Anti SNX11 pAb (ATL-HPA044787)