Anti SNX10 pAb (ATL-HPA064782)
Atlas Antibodies
- SKU:
- ATL-HPA064782-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SNX10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038301: 100%, ENSRNOG00000011944: 100%
Entrez Gene ID: 29887
Uniprot ID: Q9Y5X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCV |
Gene ID - Mouse | ENSMUSG00000038301 |
Gene ID - Rat | ENSMUSG00000038301 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNX10 pAb (ATL-HPA064782) | |
Datasheet | Anti SNX10 pAb (ATL-HPA064782) Datasheet (External Link) |
Vendor Page | Anti SNX10 pAb (ATL-HPA064782) at Atlas Antibodies |
Documents & Links for Anti SNX10 pAb (ATL-HPA064782) | |
Datasheet | Anti SNX10 pAb (ATL-HPA064782) Datasheet (External Link) |
Vendor Page | Anti SNX10 pAb (ATL-HPA064782) |