Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047373-100

• 
• 
• 

Protein Description: sorting nexin 1
Gene Name: SNX1
Alternative Gene Name: HsT17379, MGC8664, SNX1A, Vps5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032382: 88%, ENSRNOG00000017029: 89%
Entrez Gene ID: 6642
Uniprot ID: Q13596
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPI
• Gene Sequence: GGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPI
• Gene ID - Mouse: ENSMUSG00000032382
• Gene ID - Rat: ENSRNOG00000017029
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.