Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA047373-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: SNX1
Alternative Gene Name: HsT17379, MGC8664, SNX1A, Vps5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032382: 88%, ENSRNOG00000017029: 89%
Entrez Gene ID: 6642
Uniprot ID: Q13596
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPI |
Gene Sequence | GGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPI |
Gene ID - Mouse | ENSMUSG00000032382 |
Gene ID - Rat | ENSRNOG00000017029 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation) | |
Datasheet | Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation) | |
Datasheet | Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation) |