Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA047373-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: sorting nexin 1
Gene Name: SNX1
Alternative Gene Name: HsT17379, MGC8664, SNX1A, Vps5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032382: 88%, ENSRNOG00000017029: 89%
Entrez Gene ID: 6642
Uniprot ID: Q13596
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPI
Gene Sequence GGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPI
Gene ID - Mouse ENSMUSG00000032382
Gene ID - Rat ENSRNOG00000017029
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation)
Datasheet Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation)
Datasheet Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SNX1 pAb (ATL-HPA047373 w/enhanced validation)