Anti SNU13 pAb (ATL-HPA029199)

Atlas Antibodies

Catalog No.: ATL-HPA029199-25

Protein Description: SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)
Gene Name: SNU13
Alternative Gene Name: 15.5K, FA-1, NHP2L1, SNRNP15-5, SPAG12, SSFA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063480: 100%, ENSRNOG00000025154: 100%
Entrez Gene ID: 4809
Uniprot ID: P55769
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL
• Gene Sequence: TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL
• Gene ID - Mouse: ENSMUSG00000063480
• Gene ID - Rat: ENSRNOG00000025154
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.