Anti SNTB1 pAb (ATL-HPA024659)

Atlas Antibodies

Catalog No.: ATL-HPA024659-25

Protein Description: syntrophin, beta 1 (dystrophin-associated protein A1, 59kDa, basic component 1)
Gene Name: SNTB1
Alternative Gene Name: 59-DAP, A1B, BSYN2, SNT2, SNT2B1, TIP-43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060429: 91%, ENSRNOG00000004821: 91%
Entrez Gene ID: 6641
Uniprot ID: Q13884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGCHNSAELIAEISTACTYKNQECRLTIHYENGFSITTEPQEGAFPKTIIQSPYEKLKMSSDDG
• Gene Sequence: QGCHNSAELIAEISTACTYKNQECRLTIHYENGFSITTEPQEGAFPKTIIQSPYEKLKMSSDDG
• Gene ID - Mouse: ENSMUSG00000060429
• Gene ID - Rat: ENSRNOG00000004821
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNTB1 pAb (ATL-HPA024659) – 1 Found

Obinata, Daisuke; Funakoshi, Daigo; Takayama, Kenichi; Hara, Makoto; Niranjan, Birunthi; Teng, Linda; Lawrence, Mitchell G; Taylor, Renea A; Risbridger, Gail P; Suzuki, Yutaka; Takahashi, Satoru; Inoue, Satoshi. OCT1-target neural gene PFN2 promotes tumor growth in androgen receptor-negative prostate cancer. Scientific Reports. 2022;12(1):6094.