Anti SNRPA1 pAb (ATL-HPA045622)

Atlas Antibodies

SKU: ATL-HPA045622-25

• 
• 
• 

Protein Description: small nuclear ribonucleoprotein polypeptide A'
Gene Name: SNRPA1
Alternative Gene Name: Lea1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030512: 99%, ENSRNOG00000011932: 99%
Entrez Gene ID: 6627
Uniprot ID: P09661
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP
• Gene Sequence: VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP
• Gene ID - Mouse: ENSMUSG00000030512
• Gene ID - Rat: ENSRNOG00000011932
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNRPA1 pAb (ATL-HPA045622) – 1 Found

Yuan, Penghui; Ling, Le; Gao, Xintao; Sun, Taotao; Miao, Jianping; Yuan, Xianglin; Liu, Jihong; Wang, Zhihua; Liu, Bo. Identification of RNA-binding protein SNRPA1 for prognosis in prostate cancer. Aging. 2021;13(2):2895-2911.