Anti SNRPA1 pAb (ATL-HPA045622)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045622-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SNRPA1
Alternative Gene Name: Lea1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030512: 99%, ENSRNOG00000011932: 99%
Entrez Gene ID: 6627
Uniprot ID: P09661
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP |
Gene Sequence | VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP |
Gene ID - Mouse | ENSMUSG00000030512 |
Gene ID - Rat | ENSRNOG00000011932 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNRPA1 pAb (ATL-HPA045622) | |
Datasheet | Anti SNRPA1 pAb (ATL-HPA045622) Datasheet (External Link) |
Vendor Page | Anti SNRPA1 pAb (ATL-HPA045622) at Atlas Antibodies |
Documents & Links for Anti SNRPA1 pAb (ATL-HPA045622) | |
Datasheet | Anti SNRPA1 pAb (ATL-HPA045622) Datasheet (External Link) |
Vendor Page | Anti SNRPA1 pAb (ATL-HPA045622) |
Citations for Anti SNRPA1 pAb (ATL-HPA045622) – 1 Found |
Yuan, Penghui; Ling, Le; Gao, Xintao; Sun, Taotao; Miao, Jianping; Yuan, Xianglin; Liu, Jihong; Wang, Zhihua; Liu, Bo. Identification of RNA-binding protein SNRPA1 for prognosis in prostate cancer. Aging. 2021;13(2):2895-2911. PubMed |