Anti SNRPA pAb (ATL-HPA046440)

Atlas Antibodies

Catalog No.:
ATL-HPA046440-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: small nuclear ribonucleoprotein polypeptide A
Gene Name: SNRPA
Alternative Gene Name: Mud1, U1-A, U1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061479: 92%, ENSRNOG00000001501: 95%
Entrez Gene ID: 6626
Uniprot ID: P09012
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP
Gene Sequence IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP
Gene ID - Mouse ENSMUSG00000061479
Gene ID - Rat ENSRNOG00000001501
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNRPA pAb (ATL-HPA046440)
Datasheet Anti SNRPA pAb (ATL-HPA046440) Datasheet (External Link)
Vendor Page Anti SNRPA pAb (ATL-HPA046440) at Atlas Antibodies

Documents & Links for Anti SNRPA pAb (ATL-HPA046440)
Datasheet Anti SNRPA pAb (ATL-HPA046440) Datasheet (External Link)
Vendor Page Anti SNRPA pAb (ATL-HPA046440)