Anti SNRPA pAb (ATL-HPA046440)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046440-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SNRPA
Alternative Gene Name: Mud1, U1-A, U1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061479: 92%, ENSRNOG00000001501: 95%
Entrez Gene ID: 6626
Uniprot ID: P09012
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP |
Gene Sequence | IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP |
Gene ID - Mouse | ENSMUSG00000061479 |
Gene ID - Rat | ENSRNOG00000001501 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNRPA pAb (ATL-HPA046440) | |
Datasheet | Anti SNRPA pAb (ATL-HPA046440) Datasheet (External Link) |
Vendor Page | Anti SNRPA pAb (ATL-HPA046440) at Atlas Antibodies |
Documents & Links for Anti SNRPA pAb (ATL-HPA046440) | |
Datasheet | Anti SNRPA pAb (ATL-HPA046440) Datasheet (External Link) |
Vendor Page | Anti SNRPA pAb (ATL-HPA046440) |