Anti SNRNP70 pAb (ATL-HPA043516)

Atlas Antibodies

Catalog No.: ATL-HPA043516-25

Protein Description: small nuclear ribonucleoprotein 70kDa (U1)
Gene Name: SNRNP70
Alternative Gene Name: RNPU1Z, RPU1, Snp1, SNRP70, U1-70K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063511: 100%, ENSRNOG00000020763: 100%
Entrez Gene ID: 6625
Uniprot ID: P08621
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGW
• Gene Sequence: GDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGW
• Gene ID - Mouse: ENSMUSG00000063511
• Gene ID - Rat: ENSRNOG00000020763
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNRNP70 pAb (ATL-HPA043516) – 1 Found

Guo, Yang Eric; Manteiga, John C; Henninger, Jonathan E; Sabari, Benjamin R; Dall'Agnese, Alessandra; Hannett, Nancy M; Spille, Jan-Hendrik; Afeyan, Lena K; Zamudio, Alicia V; Shrinivas, Krishna; Abraham, Brian J; Boija, Ann; Decker, Tim-Michael; Rimel, Jenna K; Fant, Charli B; Lee, Tong Ihn; Cisse, Ibrahim I; Sharp, Phillip A; Taatjes, Dylan J; Young, Richard A. Pol II phosphorylation regulates a switch between transcriptional and splicing condensates. Nature. 2019;572(7770):543-548.