Anti SNN pAb (ATL-HPA011055 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA011055-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: stannin
Gene Name: SNN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037972: 95%, ENSRNOG00000058739: 95%
Entrez Gene ID: 8303
Uniprot ID: O75324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV
Gene Sequence EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV
Gene ID - Mouse ENSMUSG00000037972
Gene ID - Rat ENSRNOG00000058739
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNN pAb (ATL-HPA011055 w/enhanced validation)
Datasheet Anti SNN pAb (ATL-HPA011055 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SNN pAb (ATL-HPA011055 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SNN pAb (ATL-HPA011055 w/enhanced validation)
Datasheet Anti SNN pAb (ATL-HPA011055 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SNN pAb (ATL-HPA011055 w/enhanced validation)