Anti SNN pAb (ATL-HPA011055 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011055-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SNN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037972: 95%, ENSRNOG00000058739: 95%
Entrez Gene ID: 8303
Uniprot ID: O75324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV |
| Gene Sequence | EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV |
| Gene ID - Mouse | ENSMUSG00000037972 |
| Gene ID - Rat | ENSRNOG00000058739 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SNN pAb (ATL-HPA011055 w/enhanced validation) | |
| Datasheet | Anti SNN pAb (ATL-HPA011055 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SNN pAb (ATL-HPA011055 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SNN pAb (ATL-HPA011055 w/enhanced validation) | |
| Datasheet | Anti SNN pAb (ATL-HPA011055 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SNN pAb (ATL-HPA011055 w/enhanced validation) |