Anti SNED1 pAb (ATL-HPA036414)

Atlas Antibodies

Catalog No.: ATL-HPA036414-25

Protein Description: sushi, nidogen and EGF-like domains 1
Gene Name: SNED1
Alternative Gene Name: FLJ00133, Snep, SST3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047793: 74%, ENSRNOG00000023548: 70%
Entrez Gene ID: 25992
Uniprot ID: Q8TER0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVRVSIRHPEALRDQATDVDRSVDRFTFRALLPGKRYTIQLTTLSGLRGEEHPTESLATAPTHVWTRPLPPANLTAARVTATSA
• Gene Sequence: GVRVSIRHPEALRDQATDVDRSVDRFTFRALLPGKRYTIQLTTLSGLRGEEHPTESLATAPTHVWTRPLPPANLTAARVTATSA
• Gene ID - Mouse: ENSMUSG00000047793
• Gene ID - Rat: ENSRNOG00000023548
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNED1 pAb (ATL-HPA036414) – 1 Found

Lindskog, Cecilia; Korsgren, Olle; Pontén, Fredrik; Eriksson, Jan W; Johansson, Lars; Danielsson, Angelika. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. Journal Of Proteomics. 2012;75(9):2611-20.