Anti SND1 pAb (ATL-HPA002529 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002529-25

Protein Description: staphylococcal nuclease and tudor domain containing 1
Gene Name: SND1
Alternative Gene Name: p100, TDRD11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001424: 100%, ENSRNOG00000031173: 100%
Entrez Gene ID: 27044
Uniprot ID: Q7KZF4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL
• Gene Sequence: ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL
• Gene ID - Mouse: ENSMUSG00000001424
• Gene ID - Rat: ENSRNOG00000031173
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SND1 pAb (ATL-HPA002529 w/enhanced validation) – 1 Found

Shen, Minhong; Smith, Heath A; Wei, Yong; Jiang, Yi-Zhou; Zhao, Sheng; Wang, Nicole; Rowicki, Michelle; Tang, Yong; Hang, Xiang; Wu, Songyang; Wan, Liling; Shao, Zhi-Ming; Kang, Yibin. Pharmacological disruption of the MTDH-SND1 complex enhances tumor antigen presentation and synergizes with anti-PD-1 therapy in metastatic breast cancer. Nature Cancer. 2022;3(1):60-74.