Anti SMYD4 pAb (ATL-HPA030059)

Atlas Antibodies

Catalog No.:
ATL-HPA030059-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SET and MYND domain containing 4
Gene Name: SMYD4
Alternative Gene Name: KIAA1936, ZMYND21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018809: 64%, ENSRNOG00000026783: 65%
Entrez Gene ID: 114826
Uniprot ID: Q8IYR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACQTEAHRMAAGPRWEAFCCNSCGAPMQGDDVLRCGSRSCAESAVSRDHLVSRLQDLQQQVRVAQKLLRDGELERAVQRLSGCQR
Gene Sequence ACQTEAHRMAAGPRWEAFCCNSCGAPMQGDDVLRCGSRSCAESAVSRDHLVSRLQDLQQQVRVAQKLLRDGELERAVQRLSGCQR
Gene ID - Mouse ENSMUSG00000018809
Gene ID - Rat ENSRNOG00000026783
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMYD4 pAb (ATL-HPA030059)
Datasheet Anti SMYD4 pAb (ATL-HPA030059) Datasheet (External Link)
Vendor Page Anti SMYD4 pAb (ATL-HPA030059) at Atlas Antibodies

Documents & Links for Anti SMYD4 pAb (ATL-HPA030059)
Datasheet Anti SMYD4 pAb (ATL-HPA030059) Datasheet (External Link)
Vendor Page Anti SMYD4 pAb (ATL-HPA030059)