Anti SMYD3 pAb (ATL-HPA045821)

Atlas Antibodies

Catalog No.:
ATL-HPA045821-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SET and MYND domain containing 3
Gene Name: SMYD3
Alternative Gene Name: KMT3E, ZMYND1, ZNFN3A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055067: 94%, ENSRNOG00000003583: 27%
Entrez Gene ID: 64754
Uniprot ID: Q9H7B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIM
Gene Sequence AMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIM
Gene ID - Mouse ENSMUSG00000055067
Gene ID - Rat ENSRNOG00000003583
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMYD3 pAb (ATL-HPA045821)
Datasheet Anti SMYD3 pAb (ATL-HPA045821) Datasheet (External Link)
Vendor Page Anti SMYD3 pAb (ATL-HPA045821) at Atlas Antibodies

Documents & Links for Anti SMYD3 pAb (ATL-HPA045821)
Datasheet Anti SMYD3 pAb (ATL-HPA045821) Datasheet (External Link)
Vendor Page Anti SMYD3 pAb (ATL-HPA045821)