Anti SMURF1 pAb (ATL-HPA019671)

Atlas Antibodies

Catalog No.: ATL-HPA019671-25

Protein Description: SMAD specific E3 ubiquitin protein ligase 1
Gene Name: SMURF1
Alternative Gene Name: KIAA1625
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038780: 92%, ENSRNOG00000000999: 94%
Entrez Gene ID: 57154
Uniprot ID: Q9HCE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHG
• Gene Sequence: RGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHG
• Gene ID - Mouse: ENSMUSG00000038780
• Gene ID - Rat: ENSRNOG00000000999
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.