Anti SMPD4 pAb (ATL-HPA046279)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046279-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SMPD4
Alternative Gene Name: FLJ20297, FLJ20756, KIAA1418, NET13, nSMase-3, NSMASE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005899: 92%, ENSRNOG00000001875: 94%
Entrez Gene ID: 55627
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASLKADSINKPFAQQCQDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSIVMEFLDPGGPMMKLVYKLQAEDYKFDFPVSY |
Gene Sequence | ASLKADSINKPFAQQCQDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSIVMEFLDPGGPMMKLVYKLQAEDYKFDFPVSY |
Gene ID - Mouse | ENSMUSG00000005899 |
Gene ID - Rat | ENSRNOG00000001875 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SMPD4 pAb (ATL-HPA046279) | |
Datasheet | Anti SMPD4 pAb (ATL-HPA046279) Datasheet (External Link) |
Vendor Page | Anti SMPD4 pAb (ATL-HPA046279) at Atlas Antibodies |
Documents & Links for Anti SMPD4 pAb (ATL-HPA046279) | |
Datasheet | Anti SMPD4 pAb (ATL-HPA046279) Datasheet (External Link) |
Vendor Page | Anti SMPD4 pAb (ATL-HPA046279) |