Anti SMN1 pAb (ATL-HPA045271)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045271-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SMN1
Alternative Gene Name: BCD541, GEMIN1, SMA, SMA1, SMA2, SMA3, SMA@, SMNT, TDRD16A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021645: 87%, ENSRNOG00000018067: 85%
Entrez Gene ID: 6606
Uniprot ID: Q16637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYP |
| Gene Sequence | EDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYP |
| Gene ID - Mouse | ENSMUSG00000021645 |
| Gene ID - Rat | ENSRNOG00000018067 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SMN1 pAb (ATL-HPA045271) | |
| Datasheet | Anti SMN1 pAb (ATL-HPA045271) Datasheet (External Link) |
| Vendor Page | Anti SMN1 pAb (ATL-HPA045271) at Atlas Antibodies |
| Documents & Links for Anti SMN1 pAb (ATL-HPA045271) | |
| Datasheet | Anti SMN1 pAb (ATL-HPA045271) Datasheet (External Link) |
| Vendor Page | Anti SMN1 pAb (ATL-HPA045271) |