Anti SMN1 pAb (ATL-HPA045271)

Atlas Antibodies

Catalog No.:
ATL-HPA045271-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: survival of motor neuron 1, telomeric
Gene Name: SMN1
Alternative Gene Name: BCD541, GEMIN1, SMA, SMA1, SMA2, SMA3, SMA@, SMNT, TDRD16A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021645: 87%, ENSRNOG00000018067: 85%
Entrez Gene ID: 6606
Uniprot ID: Q16637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYP
Gene Sequence EDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYP
Gene ID - Mouse ENSMUSG00000021645
Gene ID - Rat ENSRNOG00000018067
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMN1 pAb (ATL-HPA045271)
Datasheet Anti SMN1 pAb (ATL-HPA045271) Datasheet (External Link)
Vendor Page Anti SMN1 pAb (ATL-HPA045271) at Atlas Antibodies

Documents & Links for Anti SMN1 pAb (ATL-HPA045271)
Datasheet Anti SMN1 pAb (ATL-HPA045271) Datasheet (External Link)
Vendor Page Anti SMN1 pAb (ATL-HPA045271)