Anti SMIM4 pAb (ATL-HPA047771)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047771-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SMIM4
Alternative Gene Name: C3orf78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058351: 97%, ENSRNOG00000033508: 37%
Entrez Gene ID:
Uniprot ID: Q8WVI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IKVRVGQETFYDVYRRKASERQYQRRLEDE |
| Gene Sequence | IKVRVGQETFYDVYRRKASERQYQRRLEDE |
| Gene ID - Mouse | ENSMUSG00000058351 |
| Gene ID - Rat | ENSRNOG00000033508 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SMIM4 pAb (ATL-HPA047771) | |
| Datasheet | Anti SMIM4 pAb (ATL-HPA047771) Datasheet (External Link) |
| Vendor Page | Anti SMIM4 pAb (ATL-HPA047771) at Atlas Antibodies |
| Documents & Links for Anti SMIM4 pAb (ATL-HPA047771) | |
| Datasheet | Anti SMIM4 pAb (ATL-HPA047771) Datasheet (External Link) |
| Vendor Page | Anti SMIM4 pAb (ATL-HPA047771) |