Anti SMCP pAb (ATL-HPA035105 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035105-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: sperm mitochondria-associated cysteine-rich protein
Gene Name: SMCP
Alternative Gene Name: MCSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074435: 41%, ENSRNOG00000012993: 39%
Entrez Gene ID: 4184
Uniprot ID: P49901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQ
Gene Sequence KHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQ
Gene ID - Mouse ENSMUSG00000074435
Gene ID - Rat ENSRNOG00000012993
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMCP pAb (ATL-HPA035105 w/enhanced validation)
Datasheet Anti SMCP pAb (ATL-HPA035105 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SMCP pAb (ATL-HPA035105 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SMCP pAb (ATL-HPA035105 w/enhanced validation)
Datasheet Anti SMCP pAb (ATL-HPA035105 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SMCP pAb (ATL-HPA035105 w/enhanced validation)
Citations for Anti SMCP pAb (ATL-HPA035105 w/enhanced validation) – 1 Found
Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.  PubMed