Anti SMCO3 pAb (ATL-HPA047804)

Atlas Antibodies

Catalog No.:
ATL-HPA047804-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: single-pass membrane protein with coiled-coil domains 3
Gene Name: SMCO3
Alternative Gene Name: C12orf69, LOC440087
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043298: 84%, ENSRNOG00000048722: 79%
Entrez Gene ID: 440087
Uniprot ID: A2RU48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGRRLASIEMKRDGTIKENCDLIIQAIMK
Gene Sequence MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGRRLASIEMKRDGTIKENCDLIIQAIMK
Gene ID - Mouse ENSMUSG00000043298
Gene ID - Rat ENSRNOG00000048722
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMCO3 pAb (ATL-HPA047804)
Datasheet Anti SMCO3 pAb (ATL-HPA047804) Datasheet (External Link)
Vendor Page Anti SMCO3 pAb (ATL-HPA047804) at Atlas Antibodies

Documents & Links for Anti SMCO3 pAb (ATL-HPA047804)
Datasheet Anti SMCO3 pAb (ATL-HPA047804) Datasheet (External Link)
Vendor Page Anti SMCO3 pAb (ATL-HPA047804)