Anti SMC4 pAb (ATL-HPA029449)

Atlas Antibodies

Catalog No.: ATL-HPA029449-25

Protein Description: structural maintenance of chromosomes 4
Gene Name: SMC4
Alternative Gene Name: CAP-C, hCAP-C, SMC4L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034349: 92%, ENSRNOG00000010274: 92%
Entrez Gene ID: 10051
Uniprot ID: Q9NTJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLTQEETNFKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYDVAISSCCHALDYIVVDSIDIAQECVNFLKRQNIGVATFIGLDKMAVWAKKMTEIQTPENTPRL
• Gene Sequence: KLTQEETNFKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYDVAISSCCHALDYIVVDSIDIAQECVNFLKRQNIGVATFIGLDKMAVWAKKMTEIQTPENTPRL
• Gene ID - Mouse: ENSMUSG00000034349
• Gene ID - Rat: ENSRNOG00000010274
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SMC4 pAb (ATL-HPA029449) – 1 Found

Song, Cheng; Pan, Bo; Yang, Xiao; Tang, Wei. Polyphyllin VII suppresses cell proliferation, the cell cycle and cell migration in colorectal cancer. Oncology Letters. 2021;21(1):25.