Anti SMC3 pAb (ATL-HPA037411)

Atlas Antibodies

Catalog No.:
ATL-HPA037411-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: structural maintenance of chromosomes 3
Gene Name: SMC3
Alternative Gene Name: BAM, bamacan, CSPG6, HCAP, SMC3L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024974: 100%, ENSRNOG00000014173: 100%
Entrez Gene ID: 9126
Uniprot ID: Q9UQE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRG
Gene Sequence EFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRG
Gene ID - Mouse ENSMUSG00000024974
Gene ID - Rat ENSRNOG00000014173
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMC3 pAb (ATL-HPA037411)
Datasheet Anti SMC3 pAb (ATL-HPA037411) Datasheet (External Link)
Vendor Page Anti SMC3 pAb (ATL-HPA037411) at Atlas Antibodies

Documents & Links for Anti SMC3 pAb (ATL-HPA037411)
Datasheet Anti SMC3 pAb (ATL-HPA037411) Datasheet (External Link)
Vendor Page Anti SMC3 pAb (ATL-HPA037411)