Anti SMC3 pAb (ATL-HPA037411)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037411-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: SMC3
Alternative Gene Name: BAM, bamacan, CSPG6, HCAP, SMC3L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024974: 100%, ENSRNOG00000014173: 100%
Entrez Gene ID: 9126
Uniprot ID: Q9UQE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRG |
| Gene Sequence | EFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRG |
| Gene ID - Mouse | ENSMUSG00000024974 |
| Gene ID - Rat | ENSRNOG00000014173 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SMC3 pAb (ATL-HPA037411) | |
| Datasheet | Anti SMC3 pAb (ATL-HPA037411) Datasheet (External Link) |
| Vendor Page | Anti SMC3 pAb (ATL-HPA037411) at Atlas Antibodies |
| Documents & Links for Anti SMC3 pAb (ATL-HPA037411) | |
| Datasheet | Anti SMC3 pAb (ATL-HPA037411) Datasheet (External Link) |
| Vendor Page | Anti SMC3 pAb (ATL-HPA037411) |