Anti SMARCD1 pAb (ATL-HPA004101)

Atlas Antibodies

Catalog No.: ATL-HPA004101-25

Protein Description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
Gene Name: SMARCD1
Alternative Gene Name: BAF60A, CRACD1, Rsc6p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023018: 100%, ENSRNOG00000061572: 100%
Entrez Gene ID: 6602
Uniprot ID: Q96GM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK
• Gene Sequence: MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK
• Gene ID - Mouse: ENSMUSG00000023018
• Gene ID - Rat: ENSRNOG00000061572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SMARCD1 pAb (ATL-HPA004101) – 1 Found

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.