Anti SMARCA5 pAb (ATL-HPA008751 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008751-25

Protein Description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Gene Name: SMARCA5
Alternative Gene Name: hISWI, hSNF2H, ISWI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031715: 82%, ENSRNOG00000018149: 46%
Entrez Gene ID: 8467
Uniprot ID: O60264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPA
• Gene Sequence: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPA
• Gene ID - Mouse: ENSMUSG00000031715
• Gene ID - Rat: ENSRNOG00000018149
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SMARCA5 pAb (ATL-HPA008751 w/enhanced validation) – 3 Found

Gupta, Manoj Kumar; Polisetty, Ravindra Varma; Sharma, Rakesh; Ganesh, Raksha A; Gowda, Harsha; Purohit, Aniruddh K; Ankathi, Praveen; Prasad, Komal; Mariswamappa, Kiran; Lakshmikantha, Akhila; Uppin, Megha S; Sundaram, Challa; Gautam, Poonam; Sirdeshmukh, Ravi. Altered transcriptional regulatory proteins in glioblastoma and YBX1 as a potential regulator of tumor invasion. Scientific Reports. 2019;9(1):10986. 

Pennemann, Friederike L; Mussabekova, Assel; Urban, Christian; Stukalov, Alexey; Andersen, Line Lykke; Grass, Vincent; Lavacca, Teresa Maria; Holze, Cathleen; Oubraham, Lila; Benamrouche, Yasmine; Girardi, Enrico; Boulos, Rasha E; Hartmann, Rune; Superti-Furga, Giulio; Habjan, Matthias; Imler, Jean-Luc; Meignin, Carine; Pichlmair, Andreas. Cross-species analysis of viral nucleic acid interacting proteins identifies TAOKs as innate immune regulators. Nature Communications. 2021;12(1):7009. 

Polyakova, Oxana; Borman, Satty; Grimley, Rachel; Vamathevan, Jessica; Hayes, Brian; Solari, Roberto. Identification of novel interacting partners of Sirtuin6. Plos One. 7(12):e51555.