Anti SLF1 pAb (ATL-HPA040793)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040793-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLF1
Alternative Gene Name: ANKRD32, BRCTD1, BRCTx, DKFZp564C0469, DKFZp761C121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021597: 74%, ENSRNOG00000040279: 74%
Entrez Gene ID: 84250
Uniprot ID: Q9BQI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EYAKESKAMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESLIEGHFFKEAIEELSTLQAHYIPPVC |
| Gene Sequence | EYAKESKAMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESLIEGHFFKEAIEELSTLQAHYIPPVC |
| Gene ID - Mouse | ENSMUSG00000021597 |
| Gene ID - Rat | ENSRNOG00000040279 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLF1 pAb (ATL-HPA040793) | |
| Datasheet | Anti SLF1 pAb (ATL-HPA040793) Datasheet (External Link) |
| Vendor Page | Anti SLF1 pAb (ATL-HPA040793) at Atlas Antibodies |
| Documents & Links for Anti SLF1 pAb (ATL-HPA040793) | |
| Datasheet | Anti SLF1 pAb (ATL-HPA040793) Datasheet (External Link) |
| Vendor Page | Anti SLF1 pAb (ATL-HPA040793) |