Anti SLF1 pAb (ATL-HPA040793)

Atlas Antibodies

Catalog No.:
ATL-HPA040793-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SMC5-SMC6 complex localization factor 1
Gene Name: SLF1
Alternative Gene Name: ANKRD32, BRCTD1, BRCTx, DKFZp564C0469, DKFZp761C121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021597: 74%, ENSRNOG00000040279: 74%
Entrez Gene ID: 84250
Uniprot ID: Q9BQI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYAKESKAMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESLIEGHFFKEAIEELSTLQAHYIPPVC
Gene Sequence EYAKESKAMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESLIEGHFFKEAIEELSTLQAHYIPPVC
Gene ID - Mouse ENSMUSG00000021597
Gene ID - Rat ENSRNOG00000040279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLF1 pAb (ATL-HPA040793)
Datasheet Anti SLF1 pAb (ATL-HPA040793) Datasheet (External Link)
Vendor Page Anti SLF1 pAb (ATL-HPA040793) at Atlas Antibodies

Documents & Links for Anti SLF1 pAb (ATL-HPA040793)
Datasheet Anti SLF1 pAb (ATL-HPA040793) Datasheet (External Link)
Vendor Page Anti SLF1 pAb (ATL-HPA040793)