Anti SLCO4A1 pAb (ATL-HPA030670)

Atlas Antibodies

Catalog No.: ATL-HPA030670-25

Protein Description: solute carrier organic anion transporter family, member 4A1
Gene Name: SLCO4A1
Alternative Gene Name: OATP-E, OATP4A1, SLC21A12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038963: 82%, ENSRNOG00000053430: 78%
Entrez Gene ID: 28231
Uniprot ID: Q96BD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYPRQLPGSQRYAVMRAAEMHQLKDSSRGEASNPDFGKTIRDLPL
• Gene Sequence: GYPRQLPGSQRYAVMRAAEMHQLKDSSRGEASNPDFGKTIRDLPL
• Gene ID - Mouse: ENSMUSG00000038963
• Gene ID - Rat: ENSRNOG00000053430
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.