Anti SLC9A7 pAb (ATL-HPA048938)

Atlas Antibodies

Catalog No.:
ATL-HPA048938-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
Gene Name: SLC9A7
Alternative Gene Name: NHE7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037341: 92%, ENSRNOG00000004150: 92%
Entrez Gene ID: 84679
Uniprot ID: Q96T83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGSSSSHTASTSLEGSRRT
Gene Sequence QVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGSSSSHTASTSLEGSRRT
Gene ID - Mouse ENSMUSG00000037341
Gene ID - Rat ENSRNOG00000004150
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC9A7 pAb (ATL-HPA048938)
Datasheet Anti SLC9A7 pAb (ATL-HPA048938) Datasheet (External Link)
Vendor Page Anti SLC9A7 pAb (ATL-HPA048938) at Atlas Antibodies

Documents & Links for Anti SLC9A7 pAb (ATL-HPA048938)
Datasheet Anti SLC9A7 pAb (ATL-HPA048938) Datasheet (External Link)
Vendor Page Anti SLC9A7 pAb (ATL-HPA048938)