Anti SLC9A4 pAb (ATL-HPA036096)

Atlas Antibodies

Catalog No.: ATL-HPA036096-25

Protein Description: solute carrier family 9, subfamily A (NHE4, cation proton antiporter 4), member 4
Gene Name: SLC9A4
Alternative Gene Name: NHE4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026065: 82%, ENSRNOG00000015306: 80%
Entrez Gene ID: 389015
Uniprot ID: Q6AI14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQAIEMVETGILSSTAFSIPHQAQRIQGIKRLSPEDVESIRDILTSNMYQVRQRT
• Gene Sequence: KQAIEMVETGILSSTAFSIPHQAQRIQGIKRLSPEDVESIRDILTSNMYQVRQRT
• Gene ID - Mouse: ENSMUSG00000026065
• Gene ID - Rat: ENSRNOG00000015306
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC9A4 pAb (ATL-HPA036096) – 1 Found

Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Nemes, Szilárd; Werner Rönnerman, Elisabeth; De Lara, Shahin; Biermann, Jana; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Immunohistochemical validation of COL3A1, GPR158 and PITHD1 as prognostic biomarkers in early-stage ovarian carcinomas. Bmc Cancer. 2019;19(1):928.