Anti SLC9A3R2 pAb (ATL-HPA001672 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001672-25

Protein Description: solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Gene Name: SLC9A3R2
Alternative Gene Name: E3KARP, NHERF-2, SIP-1, TKA-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002504: 87%, ENSRNOG00000002997: 87%
Entrez Gene ID: 9351
Uniprot ID: Q15599
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH
• Gene Sequence: RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH
• Gene ID - Mouse: ENSMUSG00000002504
• Gene ID - Rat: ENSRNOG00000002997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC9A3R2 pAb (ATL-HPA001672 w/enhanced validation) – 3 Found

Yoshida, Michihiro; Zhao, Luqing; Grigoryan, Gevorg; Shim, Hyunsuk; He, Peijian; Yun, C Chris. Deletion of Na+/H+ exchanger regulatory factor 2 represses colon cancer progress by suppression of Stat3 and CD24. American Journal Of Physiology. Gastrointestinal And Liver Physiology. 2016;310(8):G586-98. 

Vogl, Christian; Butola, Tanvi; Haag, Natja; Hausrat, Torben J; Leitner, Michael G; Moutschen, Michel; Lefèbvre, Philippe P; Speckmann, Carsten; Garrett, Lillian; Becker, Lore; Fuchs, Helmut; Hrabe de Angelis, Martin; Nietzsche, Sandor; Kessels, Michael M; Oliver, Dominik; Kneussel, Matthias; Kilimann, Manfred W; Strenzke, Nicola. The BEACH protein LRBA is required for hair bundle maintenance in cochlear hair cells and for hearing. Embo Reports. 2017;18(11):2015-2029. 

Chen, Tiane; Lin, Ruxian; Avula, Leela; Sarker, Rafiquel; Yang, Jianbo; Cha, Boyoung; Tse, Chung Ming; McNamara, George; Seidler, Ursula; Waldman, Scott; Snook, Adam; Bijvelds, Marcel J C; de Jonge, Hugo R; Li, Xuhang; Donowitz, Mark. NHERF3 is necessary for Escherichia coli heat-stable enterotoxin-induced inhibition of NHE3: differences in signaling in mouse small intestine and Caco-2 cells. American Journal Of Physiology. Cell Physiology. 2019;317(4):C737-C748.