Anti SLC9A3 pAb (ATL-HPA036669 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036669-25

Protein Description: solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3
Gene Name: SLC9A3
Alternative Gene Name: NHE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036123: 78%, ENSRNOG00000015159: 79%
Entrez Gene ID: 6550
Uniprot ID: P48764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
• Gene Sequence: DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
• Gene ID - Mouse: ENSMUSG00000036123
• Gene ID - Rat: ENSRNOG00000015159
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC9A3 pAb (ATL-HPA036669 w/enhanced validation) – 3 Found

Vogel, Georg F; Janecke, Andreas R; Krainer, Iris M; Gutleben, Karin; Witting, Barbara; Mitton, Sally G; Mansour, Sahar; Ballauff, Antje; Roland, Joseph T; Engevik, Amy C; Cutz, Ernest; Müller, Thomas; Goldenring, James R; Huber, Lukas A; Hess, Michael W. Abnormal Rab11-Rab8-vesicles cluster in enterocytes of patients with microvillus inclusion disease. Traffic (Copenhagen, Denmark). 2017;18(7):453-464. 

Vogel, Georg F; van Rijn, Jorik M; Krainer, Iris M; Janecke, Andreas R; Posovszky, Carsten; Cohen, Marta; Searle, Claire; Jantchou, Prevost; Escher, Johanna C; Patey, Natalie; Cutz, Ernest; Müller, Thomas; Middendorp, Sabine; Hess, Michael W; Huber, Lukas A. Disrupted apical exocytosis of cargo vesicles causes enteropathy in FHL5 patients with Munc18-2 mutations. Jci Insight. 2017;2(14) 

Hess, Michael W; Krainer, Iris M; Filipek, Przemyslaw A; Witting, Barbara; Gutleben, Karin; Vietor, Ilja; Zoller, Heinz; Aldrian, Denise; Sturm, Ekkehard; Goldenring, James R; Janecke, Andreas R; Müller, Thomas; Huber, Lukas A; Vogel, Georg F. Advanced Microscopy for Liver and Gut Ultrastructural Pathology in Patients with MVID and PFIC Caused by MYO5B Mutations. Journal Of Clinical Medicine. 2021;10(9)