Anti SLC7A14 pAb (ATL-HPA045929)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045929-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLC7A14
Alternative Gene Name: KIAA1613, PPP1R142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069072: 95%, ENSRNOG00000028097: 95%
Entrez Gene ID: 57709
Uniprot ID: Q8TBB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLGDNEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPHYYTMRIRL |
Gene Sequence | ADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLGDNEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPHYYTMRIRL |
Gene ID - Mouse | ENSMUSG00000069072 |
Gene ID - Rat | ENSRNOG00000028097 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC7A14 pAb (ATL-HPA045929) | |
Datasheet | Anti SLC7A14 pAb (ATL-HPA045929) Datasheet (External Link) |
Vendor Page | Anti SLC7A14 pAb (ATL-HPA045929) at Atlas Antibodies |
Documents & Links for Anti SLC7A14 pAb (ATL-HPA045929) | |
Datasheet | Anti SLC7A14 pAb (ATL-HPA045929) Datasheet (External Link) |
Vendor Page | Anti SLC7A14 pAb (ATL-HPA045929) |
Citations for Anti SLC7A14 pAb (ATL-HPA045929) – 3 Found |
Li, Yi; Liu, Huizhan; Giffen, Kimberlee P; Chen, Lei; Beisel, Kirk W; He, David Z Z. Transcriptomes of cochlear inner and outer hair cells from adult mice. Scientific Data. 2018;5( 30277483):180199. PubMed |
Jin, Zi-Bing; Huang, Xiu-Feng; Lv, Ji-Neng; Xiang, Lue; Li, Dong-Qing; Chen, Jiangfei; Huang, Changjiang; Wu, Jinyu; Lu, Fan; Qu, Jia. SLC7A14 linked to autosomal recessive retinitis pigmentosa. Nature Communications. 2014;5( 24670872):3517. PubMed |
Liu, Huizhan; Giffen, Kimberlee P; Chen, Lei; Henderson, Heidi J; Cao, Talia A; Kozeny, Grant A; Beisel, Kirk W; Li, Yi; He, David Z. Molecular and cytological profiling of biological aging of mouse cochlear inner and outer hair cells. Cell Reports. 2022;39(2):110665. PubMed |