Anti SLC6A3 pAb (ATL-HPA012763)

Atlas Antibodies

Catalog No.:
ATL-HPA012763-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: solute carrier family 6 member 3
Gene Name: SLC6A3
Alternative Gene Name: DAT, DAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021609: 86%, ENSRNOG00000017302: 86%
Entrez Gene ID: 6531
Uniprot ID: Q01959
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRET
Gene Sequence SKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRET
Gene ID - Mouse ENSMUSG00000021609
Gene ID - Rat ENSRNOG00000017302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC6A3 pAb (ATL-HPA012763)
Datasheet Anti SLC6A3 pAb (ATL-HPA012763) Datasheet (External Link)
Vendor Page Anti SLC6A3 pAb (ATL-HPA012763) at Atlas Antibodies

Documents & Links for Anti SLC6A3 pAb (ATL-HPA012763)
Datasheet Anti SLC6A3 pAb (ATL-HPA012763) Datasheet (External Link)
Vendor Page Anti SLC6A3 pAb (ATL-HPA012763)