Anti SLC4A10 pAb (ATL-HPA034755 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA034755-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: solute carrier family 4, sodium bicarbonate transporter, member 10
Gene Name: SLC4A10
Alternative Gene Name: NBCn2, NCBE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026904: 89%, ENSRNOG00000005307: 91%
Entrez Gene ID: 57282
Uniprot ID: Q6U841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT
Gene Sequence FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT
Gene ID - Mouse ENSMUSG00000026904
Gene ID - Rat ENSRNOG00000005307
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC4A10 pAb (ATL-HPA034755 w/enhanced validation)
Datasheet Anti SLC4A10 pAb (ATL-HPA034755 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC4A10 pAb (ATL-HPA034755 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SLC4A10 pAb (ATL-HPA034755 w/enhanced validation)
Datasheet Anti SLC4A10 pAb (ATL-HPA034755 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC4A10 pAb (ATL-HPA034755 w/enhanced validation)