Anti SLC46A3 pAb (ATL-HPA039930)

Atlas Antibodies

Catalog No.: ATL-HPA039930-25

Protein Description: solute carrier family 46, member 3
Gene Name: SLC46A3
Alternative Gene Name: DKFZp686A1775, FLJ42613
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029650: 81%, ENSRNOG00000000937: 84%
Entrez Gene ID: 283537
Uniprot ID: Q7Z3Q1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQ
• Gene Sequence: RRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQ
• Gene ID - Mouse: ENSMUSG00000029650
• Gene ID - Rat: ENSRNOG00000000937
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.