Anti SLC41A1 pAb (ATL-HPA015138)

Atlas Antibodies

Catalog No.: ATL-HPA015138-25

Protein Description: solute carrier family 41 (magnesium transporter), member 1
Gene Name: SLC41A1
Alternative Gene Name: MgtE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013275: 95%, ENSRNOG00000042320: 95%
Entrez Gene ID: 254428
Uniprot ID: Q8IVJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSAR
• Gene Sequence: QASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSAR
• Gene ID - Mouse: ENSMUSG00000013275
• Gene ID - Rat: ENSRNOG00000042320
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.