Anti SLC35B2 pAb (ATL-HPA029638)

Atlas Antibodies

Catalog No.:
ATL-HPA029638-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Gene Name: SLC35B2
Alternative Gene Name: UGTrel4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037089: 89%, ENSRNOG00000019900: 91%
Entrez Gene ID: 347734
Uniprot ID: Q8TB61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
Gene Sequence FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
Gene ID - Mouse ENSMUSG00000037089
Gene ID - Rat ENSRNOG00000019900
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC35B2 pAb (ATL-HPA029638)
Datasheet Anti SLC35B2 pAb (ATL-HPA029638) Datasheet (External Link)
Vendor Page Anti SLC35B2 pAb (ATL-HPA029638) at Atlas Antibodies

Documents & Links for Anti SLC35B2 pAb (ATL-HPA029638)
Datasheet Anti SLC35B2 pAb (ATL-HPA029638) Datasheet (External Link)
Vendor Page Anti SLC35B2 pAb (ATL-HPA029638)