Anti SLC2A2 pAb (ATL-HPA028998)

Atlas Antibodies

Catalog No.: ATL-HPA028998-25

Protein Description: solute carrier family 2 (facilitated glucose transporter), member 2
Gene Name: SLC2A2
Alternative Gene Name: GLUT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027690: 62%, ENSRNOG00000011875: 60%
Entrez Gene ID: 6514
Uniprot ID: P11168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEE
• Gene Sequence: QVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEE
• Gene ID - Mouse: ENSMUSG00000027690
• Gene ID - Rat: ENSRNOG00000011875
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.