Anti SLC2A13 pAb (ATL-HPA006584)

Atlas Antibodies

Catalog No.: ATL-HPA006584-25

Protein Description: solute carrier family 2 (facilitated glucose transporter), member 13
Gene Name: SLC2A13
Alternative Gene Name: HMIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036298: 79%, ENSRNOG00000015741: 88%
Entrez Gene ID: 114134
Uniprot ID: Q96QE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDI
• Gene Sequence: ITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDI
• Gene ID - Mouse: ENSMUSG00000036298
• Gene ID - Rat: ENSRNOG00000015741
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.