Anti SLC29A3 pAb (ATL-HPA046085)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046085-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SLC29A3
Alternative Gene Name: ENT3, FLJ11160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020100: 64%, ENSRNOG00000000568: 62%
Entrez Gene ID: 55315
Uniprot ID: Q9BZD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRPILKKT |
Gene Sequence | YARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRPILKKT |
Gene ID - Mouse | ENSMUSG00000020100 |
Gene ID - Rat | ENSRNOG00000000568 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC29A3 pAb (ATL-HPA046085) | |
Datasheet | Anti SLC29A3 pAb (ATL-HPA046085) Datasheet (External Link) |
Vendor Page | Anti SLC29A3 pAb (ATL-HPA046085) at Atlas Antibodies |
Documents & Links for Anti SLC29A3 pAb (ATL-HPA046085) | |
Datasheet | Anti SLC29A3 pAb (ATL-HPA046085) Datasheet (External Link) |
Vendor Page | Anti SLC29A3 pAb (ATL-HPA046085) |