Anti SLC26A9 pAb (ATL-HPA051485 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA051485-25

Protein Description: solute carrier family 26 (anion exchanger), member 9
Gene Name: SLC26A9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042268: 91%, ENSRNOG00000029514: 91%
Entrez Gene ID: 115019
Uniprot ID: Q7LBE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC
• Gene Sequence: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC
• Gene ID - Mouse: ENSMUSG00000042268
• Gene ID - Rat: ENSRNOG00000029514
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.