Anti SLC26A10 pAb (ATL-HPA044719)

Atlas Antibodies

Catalog No.: ATL-HPA044719-25

Protein Description: solute carrier family 26, member 10
Gene Name: SLC26A10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040441: 64%, ENSRNOG00000029465: 69%
Entrez Gene ID: 65012
Uniprot ID: Q8NG04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGTRGQFRCNLEWHLGLGEGEKETSKPDGPMVAVAEPVRVVVLDFSGVTFADAAGAREVVQ
• Gene Sequence: FGTRGQFRCNLEWHLGLGEGEKETSKPDGPMVAVAEPVRVVVLDFSGVTFADAAGAREVVQ
• Gene ID - Mouse: ENSMUSG00000040441
• Gene ID - Rat: ENSRNOG00000029465
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC26A10 pAb (ATL-HPA044719) – 2 Found

Andharia, N; Hayashi, M; Matsuda, H. Electrophysiological properties of anion exchangers in the luminal membrane of guinea pig pancreatic duct cells. Pflugers Archiv : European Journal Of Physiology. 2018;470(6):897-907. 

Gallet, Patrice; Oussalah, Abderrahim; Pouget, Celso; Dittmar, Gunnar; Chery, Celine; Gauchotte, Guillaume; Jankowski, Roger; Gueant, Jean Louis; Houlgatte, Rémi. Integrative genomics analysis of nasal intestinal-type adenocarcinomas demonstrates the major role of CACNA1C and paves the way for a simple diagnostic tool in male woodworkers. Clinical Epigenetics. 2021;13(1):179.