Anti SLC25A37 pAb (ATL-HPA045680)

Atlas Antibodies

SKU: ATL-HPA045680-25

• 

Protein Description: solute carrier family 25 (mitochondrial iron transporter), member 37
Gene Name: SLC25A37
Alternative Gene Name: MFRN, MFRN1, MSCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034248: 78%, ENSRNOG00000015495: 78%
Entrez Gene ID: 51312
Uniprot ID: Q9NYZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARRMDGDSRDGGGGKDATGSEDYENLPTSASV
• Gene Sequence: ARRMDGDSRDGGGGKDATGSEDYENLPTSASV
• Gene ID - Mouse: ENSMUSG00000034248
• Gene ID - Rat: ENSRNOG00000015495
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.