Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028519-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SLC25A24
Alternative Gene Name: APC1, DKFZp586G0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040322: 95%, ENSRNOG00000020470: 93%
Entrez Gene ID: 29957
Uniprot ID: Q6NUK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK |
| Gene Sequence | SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK |
| Gene ID - Mouse | ENSMUSG00000040322 |
| Gene ID - Rat | ENSRNOG00000020470 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) | |
| Datasheet | Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) | |
| Datasheet | Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) |
| Citations for Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) – 2 Found |
| Ehmke, Nadja; Graul-Neumann, Luitgard; Smorag, Lukasz; Koenig, Rainer; Segebrecht, Lara; Magoulas, Pilar; Scaglia, Fernando; Kilic, Esra; Hennig, Anna F; Adolphs, Nicolai; Saha, Namrata; Fauler, Beatrix; Kalscheuer, Vera M; Hennig, Friederike; Altmüller, Janine; Netzer, Christian; Thiele, Holger; Nürnberg, Peter; Yigit, Gökhan; Jäger, Marten; Hecht, Jochen; Krüger, Ulrike; Mielke, Thorsten; Krawitz, Peter M; Horn, Denise; Schuelke, Markus; Mundlos, Stefan; Bacino, Carlos A; Bonnen, Penelope E; Wollnik, Bernd; Fischer-Zirnsak, Björn; Kornak, Uwe. De Novo Mutations in SLC25A24 Cause a Craniosynostosis Syndrome with Hypertrichosis, Progeroid Appearance, and Mitochondrial Dysfunction. American Journal Of Human Genetics. 2017;101(5):833-843. PubMed |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |