Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028519-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Gene Name: SLC25A24
Alternative Gene Name: APC1, DKFZp586G0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040322: 95%, ENSRNOG00000020470: 93%
Entrez Gene ID: 29957
Uniprot ID: Q6NUK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK
Gene Sequence SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK
Gene ID - Mouse ENSMUSG00000040322
Gene ID - Rat ENSRNOG00000020470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation)
Datasheet Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation)
Datasheet Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation)
Citations for Anti SLC25A24 pAb (ATL-HPA028519 w/enhanced validation) – 2 Found
Ehmke, Nadja; Graul-Neumann, Luitgard; Smorag, Lukasz; Koenig, Rainer; Segebrecht, Lara; Magoulas, Pilar; Scaglia, Fernando; Kilic, Esra; Hennig, Anna F; Adolphs, Nicolai; Saha, Namrata; Fauler, Beatrix; Kalscheuer, Vera M; Hennig, Friederike; Altmüller, Janine; Netzer, Christian; Thiele, Holger; Nürnberg, Peter; Yigit, Gökhan; Jäger, Marten; Hecht, Jochen; Krüger, Ulrike; Mielke, Thorsten; Krawitz, Peter M; Horn, Denise; Schuelke, Markus; Mundlos, Stefan; Bacino, Carlos A; Bonnen, Penelope E; Wollnik, Bernd; Fischer-Zirnsak, Björn; Kornak, Uwe. De Novo Mutations in SLC25A24 Cause a Craniosynostosis Syndrome with Hypertrichosis, Progeroid Appearance, and Mitochondrial Dysfunction. American Journal Of Human Genetics. 2017;101(5):833-843.  PubMed
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed