Anti SLC25A16 pAb (ATL-HPA036243)

Atlas Antibodies

Catalog No.: ATL-HPA036243-25

Protein Description: solute carrier family 25 (mitochondrial carrier), member 16
Gene Name: SLC25A16
Alternative Gene Name: D10S105E, GDA, HGT.1, ML7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071253: 89%, ENSRNOG00000000387: 91%
Entrez Gene ID: 8034
Uniprot ID: P16260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLY
• Gene Sequence: RMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLY
• Gene ID - Mouse: ENSMUSG00000071253
• Gene ID - Rat: ENSRNOG00000000387
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.