Anti SLC25A16 pAb (ATL-HPA036243)

Atlas Antibodies

Catalog No.:
ATL-HPA036243-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25 (mitochondrial carrier), member 16
Gene Name: SLC25A16
Alternative Gene Name: D10S105E, GDA, HGT.1, ML7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071253: 89%, ENSRNOG00000000387: 91%
Entrez Gene ID: 8034
Uniprot ID: P16260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLY
Gene Sequence RMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLY
Gene ID - Mouse ENSMUSG00000071253
Gene ID - Rat ENSRNOG00000000387
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A16 pAb (ATL-HPA036243)
Datasheet Anti SLC25A16 pAb (ATL-HPA036243) Datasheet (External Link)
Vendor Page Anti SLC25A16 pAb (ATL-HPA036243) at Atlas Antibodies

Documents & Links for Anti SLC25A16 pAb (ATL-HPA036243)
Datasheet Anti SLC25A16 pAb (ATL-HPA036243) Datasheet (External Link)
Vendor Page Anti SLC25A16 pAb (ATL-HPA036243)