Anti SLC25A11 pAb (ATL-HPA021167)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021167-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLC25A11
Alternative Gene Name: OGC, SLC20A4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014606: 99%, ENSRNOG00000003815: 99%
Entrez Gene ID: 8402
Uniprot ID: Q02978
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYK |
| Gene Sequence | AGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYK |
| Gene ID - Mouse | ENSMUSG00000014606 |
| Gene ID - Rat | ENSRNOG00000003815 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC25A11 pAb (ATL-HPA021167) | |
| Datasheet | Anti SLC25A11 pAb (ATL-HPA021167) Datasheet (External Link) |
| Vendor Page | Anti SLC25A11 pAb (ATL-HPA021167) at Atlas Antibodies |
| Documents & Links for Anti SLC25A11 pAb (ATL-HPA021167) | |
| Datasheet | Anti SLC25A11 pAb (ATL-HPA021167) Datasheet (External Link) |
| Vendor Page | Anti SLC25A11 pAb (ATL-HPA021167) |