Anti SLC25A11 pAb (ATL-HPA021167)

Atlas Antibodies

Catalog No.: ATL-HPA021167-25

Protein Description: solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11
Gene Name: SLC25A11
Alternative Gene Name: OGC, SLC20A4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014606: 99%, ENSRNOG00000003815: 99%
Entrez Gene ID: 8402
Uniprot ID: Q02978
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYK
• Gene Sequence: AGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYK
• Gene ID - Mouse: ENSMUSG00000014606
• Gene ID - Rat: ENSRNOG00000003815
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.