Anti SLC24A3 pAb (ATL-HPA045497)

Atlas Antibodies

Catalog No.:
ATL-HPA045497-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 24 (sodium/potassium/calcium exchanger), member 3
Gene Name: SLC24A3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063873: 100%, ENSRNOG00000060687: 100%
Entrez Gene ID: 57419
Uniprot ID: Q9HC58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSAYPHQLSF
Gene Sequence CIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSAYPHQLSF
Gene ID - Mouse ENSMUSG00000063873
Gene ID - Rat ENSRNOG00000060687
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC24A3 pAb (ATL-HPA045497)
Datasheet Anti SLC24A3 pAb (ATL-HPA045497) Datasheet (External Link)
Vendor Page Anti SLC24A3 pAb (ATL-HPA045497) at Atlas Antibodies

Documents & Links for Anti SLC24A3 pAb (ATL-HPA045497)
Datasheet Anti SLC24A3 pAb (ATL-HPA045497) Datasheet (External Link)
Vendor Page Anti SLC24A3 pAb (ATL-HPA045497)