Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008567-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SLC22A2
Alternative Gene Name: OCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040966: 84%, ENSRNOG00000016625: 77%
Entrez Gene ID: 6582
Uniprot ID: O15244
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
Gene Sequence | ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
Gene ID - Mouse | ENSMUSG00000040966 |
Gene ID - Rat | ENSRNOG00000016625 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) | |
Datasheet | Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) | |
Datasheet | Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) |
Citations for Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) – 7 Found |
Checkley, L Allyson; Rudolph, Michael C; Wellberg, Elizabeth A; Giles, Erin D; Wahdan-Alaswad, Reema S; Houck, Julie A; Edgerton, Susan M; Thor, Ann D; Schedin, Pepper; Anderson, Steven M; MacLean, Paul S. Metformin Accumulation Correlates with Organic Cation Transporter 2 Protein Expression and Predicts Mammary Tumor Regression In Vivo. Cancer Prevention Research (Philadelphia, Pa.). 2017;10(3):198-207. PubMed |
Shao, Ruijin; Li, Xin; Feng, Yi; Lin, Jin-Fang; Billig, Håkan. Direct effects of metformin in the endometrium: a hypothetical mechanism for the treatment of women with PCOS and endometrial carcinoma. Journal Of Experimental & Clinical Cancer Research : Cr. 2014;33(1):41. PubMed |
Li, Xin; Cui, Peng; Jiang, Hong-Yuan; Guo, Yan-Rong; Pishdari, Bano; Hu, Min; Feng, Yi; Billig, Håkan; Shao, Ruijin. Reversing the reduced level of endometrial GLUT4 expression in polycystic ovary syndrome: a mechanistic study of metformin action. American Journal Of Translational Research. 7(3):574-86. PubMed |
Chen, Lu; Chen, Le; Qin, Zhiyuan; Lei, Jinxiu; Ye, Sheng; Zeng, Kui; Wang, Hua; Ying, Meidan; Gao, Jianqing; Zeng, Su; Yu, Lushan. Upregulation of miR-489-3p and miR-630 inhibits oxaliplatin uptake in renal cell carcinoma by targeting OCT2. Acta Pharmaceutica Sinica. B. 2019;9(5):1008-1020. PubMed |
Chen, Lu; Wang, Zeyang; Xu, Qingwen; Liu, Yuxi; Chen, Le; Guo, Suhang; Wang, Hua; Zeng, Kui; Liu, Junqing; Zeng, Su; Yu, Lushan. The failure of DAC to induce OCT2 expression and its remission by hemoglobin-based nanocarriers under hypoxia in renal cell carcinoma. Theranostics. 10(8):3562-3578. PubMed |
Wongwan, Teerasak; Chatsudthipong, Varanuj; Soodvilai, Sunhapas. Farnesoid X Receptor Activation Stimulates Organic Cations Transport in Human Renal Proximal Tubular Cells. International Journal Of Molecular Sciences. 2020;21(17) PubMed |
Kantauskaite, Marta; Hucke, Anna; Snieder, Beatrice; Ciarimboli, Giuliano. Exacerbation of Cisplatin Cellular Toxicity by Regulation of the Human Organic Cation Transporter 2 through Angiotensin II. International Journal Of Molecular Sciences. 2022;23(24) PubMed |