Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA008567-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: solute carrier family 22 (organic cation transporter), member 2
Gene Name: SLC22A2
Alternative Gene Name: OCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040966: 84%, ENSRNOG00000016625: 77%
Entrez Gene ID: 6582
Uniprot ID: O15244
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
Gene Sequence ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
Gene ID - Mouse ENSMUSG00000040966
Gene ID - Rat ENSRNOG00000016625
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation)
Datasheet Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation)
Datasheet Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation)
Citations for Anti SLC22A2 pAb (ATL-HPA008567 w/enhanced validation) – 7 Found
Checkley, L Allyson; Rudolph, Michael C; Wellberg, Elizabeth A; Giles, Erin D; Wahdan-Alaswad, Reema S; Houck, Julie A; Edgerton, Susan M; Thor, Ann D; Schedin, Pepper; Anderson, Steven M; MacLean, Paul S. Metformin Accumulation Correlates with Organic Cation Transporter 2 Protein Expression and Predicts Mammary Tumor Regression In Vivo. Cancer Prevention Research (Philadelphia, Pa.). 2017;10(3):198-207.  PubMed
Shao, Ruijin; Li, Xin; Feng, Yi; Lin, Jin-Fang; Billig, Håkan. Direct effects of metformin in the endometrium: a hypothetical mechanism for the treatment of women with PCOS and endometrial carcinoma. Journal Of Experimental & Clinical Cancer Research : Cr. 2014;33(1):41.  PubMed
Li, Xin; Cui, Peng; Jiang, Hong-Yuan; Guo, Yan-Rong; Pishdari, Bano; Hu, Min; Feng, Yi; Billig, Håkan; Shao, Ruijin. Reversing the reduced level of endometrial GLUT4 expression in polycystic ovary syndrome: a mechanistic study of metformin action. American Journal Of Translational Research. 7(3):574-86.  PubMed
Chen, Lu; Chen, Le; Qin, Zhiyuan; Lei, Jinxiu; Ye, Sheng; Zeng, Kui; Wang, Hua; Ying, Meidan; Gao, Jianqing; Zeng, Su; Yu, Lushan. Upregulation of miR-489-3p and miR-630 inhibits oxaliplatin uptake in renal cell carcinoma by targeting OCT2. Acta Pharmaceutica Sinica. B. 2019;9(5):1008-1020.  PubMed
Chen, Lu; Wang, Zeyang; Xu, Qingwen; Liu, Yuxi; Chen, Le; Guo, Suhang; Wang, Hua; Zeng, Kui; Liu, Junqing; Zeng, Su; Yu, Lushan. The failure of DAC to induce OCT2 expression and its remission by hemoglobin-based nanocarriers under hypoxia in renal cell carcinoma. Theranostics. 10(8):3562-3578.  PubMed
Wongwan, Teerasak; Chatsudthipong, Varanuj; Soodvilai, Sunhapas. Farnesoid X Receptor Activation Stimulates Organic Cations Transport in Human Renal Proximal Tubular Cells. International Journal Of Molecular Sciences. 2020;21(17)  PubMed
Kantauskaite, Marta; Hucke, Anna; Snieder, Beatrice; Ciarimboli, Giuliano. Exacerbation of Cisplatin Cellular Toxicity by Regulation of the Human Organic Cation Transporter 2 through Angiotensin II. International Journal Of Molecular Sciences. 2022;23(24)  PubMed