Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA068288-25
  • Immunohistochemistry analysis in human duodenum and liver tissues using Anti-SLC22A18AS antibody. Corresponding SLC22A18AS RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: solute carrier family 22 (organic cation transporter), member 18 antisense
Gene Name: SLC22A18AS
Alternative Gene Name: BWR1B, BWSCR1B, ORCTL2S, p27-BWR1B, SLC22A1LS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070469: 29%, ENSRNOG00000017540: 28%
Entrez Gene ID: 5003
Uniprot ID: Q8N1D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG
Gene Sequence ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG
Gene ID - Mouse ENSMUSG00000070469
Gene ID - Rat ENSRNOG00000017540
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation)
Datasheet Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation)