Anti SLC22A18AS pAb (ATL-HPA068288 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA068288-25

• 
• 
• 

Protein Description: solute carrier family 22 (organic cation transporter), member 18 antisense
Gene Name: SLC22A18AS
Alternative Gene Name: BWR1B, BWSCR1B, ORCTL2S, p27-BWR1B, SLC22A1LS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070469: 29%, ENSRNOG00000017540: 28%
Entrez Gene ID: 5003
Uniprot ID: Q8N1D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG
• Gene Sequence: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG
• Gene ID - Mouse: ENSMUSG00000070469
• Gene ID - Rat: ENSRNOG00000017540
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.