Anti SLC22A15 pAb (ATL-HPA019785)

Atlas Antibodies

Catalog No.: ATL-HPA019785-25

Protein Description: solute carrier family 22, member 15
Gene Name: SLC22A15
Alternative Gene Name: FLIPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033147: 94%, ENSRNOG00000033051: 98%
Entrez Gene ID: 55356
Uniprot ID: Q8IZD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR
• Gene Sequence: ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR
• Gene ID - Mouse: ENSMUSG00000033147
• Gene ID - Rat: ENSRNOG00000033051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.