Anti SLC22A12 pAb (ATL-HPA024575 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024575-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLC22A12
Alternative Gene Name: OAT4L, RST, URAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107099: 67%, ENSRNOG00000021108: 64%
Entrez Gene ID: 116085
Uniprot ID: Q96S37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCI |
| Gene Sequence | ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCI |
| Gene ID - Mouse | ENSMUSG00000107099 |
| Gene ID - Rat | ENSRNOG00000021108 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC22A12 pAb (ATL-HPA024575 w/enhanced validation) | |
| Datasheet | Anti SLC22A12 pAb (ATL-HPA024575 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC22A12 pAb (ATL-HPA024575 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SLC22A12 pAb (ATL-HPA024575 w/enhanced validation) | |
| Datasheet | Anti SLC22A12 pAb (ATL-HPA024575 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC22A12 pAb (ATL-HPA024575 w/enhanced validation) |
| Citations for Anti SLC22A12 pAb (ATL-HPA024575 w/enhanced validation) – 5 Found |
| Bolar, Nikhita Ajit; Golzio, Christelle; Živná, Martina; Hayot, Gaëlle; Van Hemelrijk, Christine; Schepers, Dorien; Vandeweyer, Geert; Hoischen, Alexander; Huyghe, Jeroen R; Raes, Ann; Matthys, Erve; Sys, Emiel; Azou, Myriam; Gubler, Marie-Claire; Praet, Marleen; Van Camp, Guy; McFadden, Kelsey; Pediaditakis, Igor; Přistoupilová, Anna; Hodaňová, Kateřina; Vyleťal, Petr; Hartmannová, Hana; Stránecký, Viktor; Hůlková, Helena; Barešová, Veronika; Jedličková, Ivana; Sovová, Jana; Hnízda, Aleš; Kidd, Kendrah; Bleyer, Anthony J; Spong, Richard S; Vande Walle, Johan; Mortier, Geert; Brunner, Han; Van Laer, Lut; Kmoch, Stanislav; Katsanis, Nicholas; Loeys, Bart L. Heterozygous Loss-of-Function SEC61A1 Mutations Cause Autosomal-Dominant Tubulo-Interstitial and Glomerulocystic Kidney Disease with Anemia. American Journal Of Human Genetics. 2016;99(1):174-87. PubMed |
| Dufour, Inès; Werion, Alexis; Belkhir, Leila; Wisniewska, Anastazja; Perrot, Marie; De Greef, Julien; Schmit, Gregory; Yombi, Jean Cyr; Wittebole, Xavier; Laterre, Pierre-François; Jadoul, Michel; Gérard, Ludovic; Morelle, Johann. Serum uric acid, disease severity and outcomes in COVID-19. Critical Care (London, England). 2021;25(1):212. PubMed |
| O'Hagan, Steve; Wright Muelas, Marina; Day, Philip J; Lundberg, Emma; Kell, Douglas B. GeneGini: Assessment via the Gini Coefficient of Reference "Housekeeping" Genes and Diverse Human Transporter Expression Profiles. Cell Systems. 2018;6(2):230-244.e1. PubMed |
| Matsubayashi, Masaya; Sakaguchi, Yoshihiko M; Sahara, Yoshiki; Nanaura, Hitoki; Kikuchi, Sotaro; Asghari, Arvand; Bui, Linh; Kobashigawa, Shinko; Nakanishi, Mari; Nagata, Riko; Matsui, Takeshi K; Kashino, Genro; Hasegawa, Masatoshi; Takasawa, Shin; Eriguchi, Masahiro; Tsuruya, Kazuhiko; Nagamori, Shushi; Sugie, Kazuma; Nakagawa, Takahiko; Takasato, Minoru; Umetani, Michihisa; Mori, Eiichiro. 27-Hydroxycholesterol regulates human SLC22A12 gene expression through estrogen receptor action. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2021;35(1):e21262. PubMed |
| Nayak, Debasis; Weadick, Brenna; Persaud, Avinash K; Raj, Radhika; Shakya, Reena; Li, Junan; Campbell, Moray J; Govindarajan, Rajgopal. EMT alterations in the solute carrier landscape uncover SLC22A10/A15 imposed vulnerabilities in pancreatic cancer. Iscience. 2022;25(5):104193. PubMed |