Anti SLC22A11 pAb (ATL-HPA026076)

Atlas Antibodies

Catalog No.:
ATL-HPA026076-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 22 (organic anion/urate transporter), member 11
Gene Name: SLC22A11
Alternative Gene Name: OAT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052562: 50%, ENSRNOG00000004958: 52%
Entrez Gene ID: 55867
Uniprot ID: Q9NSA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RWLIIKGKPDQALQELRKVARINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPV
Gene Sequence RWLIIKGKPDQALQELRKVARINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPV
Gene ID - Mouse ENSMUSG00000052562
Gene ID - Rat ENSRNOG00000004958
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC22A11 pAb (ATL-HPA026076)
Datasheet Anti SLC22A11 pAb (ATL-HPA026076) Datasheet (External Link)
Vendor Page Anti SLC22A11 pAb (ATL-HPA026076) at Atlas Antibodies

Documents & Links for Anti SLC22A11 pAb (ATL-HPA026076)
Datasheet Anti SLC22A11 pAb (ATL-HPA026076) Datasheet (External Link)
Vendor Page Anti SLC22A11 pAb (ATL-HPA026076)